PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC08G20900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 153aa    MW: 16398.2 Da    PI: 8.7222
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC08G20900.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_154.91.8e-1770125358
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                      +++r rr++kNRe+A rsR+RK+a+++eLe++v  L aeN aL+++  elk  +a+
  OPUNC08G20900.1  70 ADRRKRRAMKNRESAERSRARKQAYLQELEQEVRLLRAENAALRDQCHELKAAAAE 125
                      589***********************************************988775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.5E-1068132IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.58870120IPR004827Basic-leucine zipper domain
PfamPF001701.2E-1471122IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.63E-1172122No hitNo description
Gene3DG3DSA:1.20.5.1701.5E-1372125No hitNo description
CDDcd147071.50E-1872119No hitNo description
PROSITE patternPS0003607590IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MERAGGSGSV GDDDYLVLPP ASSQDGLDLC RPLPSSRYSG GGGAVASLEQ ELLDRAELHQ  60
QQHDAAGGGA DRRKRRAMKN RESAERSRAR KQAYLQELEQ EVRLLRAENA ALRDQCHELK  120
AAAAEAEEAA AAAAAAAKKK KKPTIQRTSS ATF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8360231e-113CT836023.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN045B18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649649.13e-46PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5
SwissprotQ84JK21e-16FD_ARATH; Protein FD
TrEMBLA0A0E0LXQ31e-104A0A0E0LXQ3_ORYPU; Uncharacterized protein
STRINGORGLA08G0216500.11e-47(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP151931719